Zhangzhou Sinobioway Peptide Co.,Ltd.

Cagrilintide is a potent long-acting acylated amylin analogue that effectively targets amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). It has been shown to induce significant weight loss and reduce food intake, making it a highly promising compound for obesity treatment. In vivo studies have demonstrated Cagrilintide’s efficacy in reducing food intake in animal models, with sustained effects over several days. Currently, Cagrilintide is being used in clinical settings to explore its full potential in addressing obesity and related metabolic conditions.

· Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)

· Sequence Shortening: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)

· Molecular Formula: C194H312N54O59S2

· Molecular Weight: 4409.01 g/mol

· CAS Number: 1415456-99-3

1. Weight Loss Efficacy: Cagrilintide has demonstrated significant weight loss potential, reducing food intake in animal studies with sustained effects at doses ranging from 1-10 nmol/kg.

2. Pharmacokinetics: Cagrilintide exhibits favorable pharmacokinetic properties, delivering effective results when administered subcutaneously or intravenously.

3. Clinical Application: Cagrilintide is actively used in clinical trials to further assess its efficacy in treating obesity, overweight conditions, and related metabolic disorders.

4. Obesity Treatment Potential: With its dual mechanism of action, Cagrilintide is positioned as a leading option in the fight against obesity, offering a new and promising approach to weight management.

· Important Notices:

· This product is sold for scientific research purposes only.